SCOP 1.73: Domain d1kekb1: 1kek B:2-258

Lineage for d1kekb1 (1kek B:2-258)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465

4. Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families)
   there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
   two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules

5. Family c.36.1.8: PFOR Pyr module [88746] (1 protein)
   domains VI, I and II are arranged in the same way as the TK PP, Pyr and C domains

6. Protein Pyruvate-ferredoxin oxidoreductase, PFOR, domain I [88747] (1 species)

7. Species Desulfovibrio africanus [TaxId:873] [88748] (9 PDB entries)

8. Domain d1kekb1: 1kek B:2-258 [68529]
   Other proteins in same PDB: d1keka2, d1keka3, d1keka4, d1keka5, d1kekb2, d1kekb3, d1kekb4, d1kekb5
   complexed with ca, co2, fs4, htl, mg

Details for d1kekb1

PDB Entry: 1kek, 1.9 Å

PDB Description: Crystal Structure of the Free Radical Intermediate of Pyruvate:Ferredoxin Oxidoreductase

PDB Compounds: (B:) pyruvate-ferredoxin oxidoreductase

SCOP Domain Sequences for d1kekb1:

Sequence; same for both SEQRES and ATOM records:

>d1kekb1 c.36.1.8 (B:2-258) Pyruvate-ferredoxin oxidoreductase, PFOR, domain I {Desulfovibrio africanus [TaxId: 873]}
gkkmmttdgntatahvayamsevaaiypitpsstmgeeaddwaaqgrknifgqtltirem
qseagaagavhgalaagaltttftasqglllmipnmykisgellpgvfhvtaraiaahal
sifgdhqdiyaarqtgfamlasssvqeahdmalvahlaaiesnvpfmhffdgfrtsheiq
kievldyadmaslvnqkalaefraksmnpehphvrgtaqnpdiyfqgreaanpyylkvpg
ivaeymqkvasltgrsy

Timeline for d1kekb1:

• d1kekb1 first appeared in SCOP 1.59
  
• d1kekb1 appears in SCOP 1.71
  
• d1kekb1 appears in SCOP 1.75
  
• d1kekb1 appears in the current release, SCOPe 2.08