Lineage for d1keeg2 (1kee G:936-1073)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 391897Fold c.24: Methylglyoxal synthase-like [52334] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145
  4. 391898Superfamily c.24.1: Methylglyoxal synthase-like [52335] (3 families) (S)
    contains a common phosphate-binding site
  5. 391899Family c.24.1.1: Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain [52336] (1 protein)
  6. 391900Protein Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain [52337] (1 species)
  7. 391901Species Escherichia coli [TaxId:562] [52338] (9 PDB entries)
  8. 391929Domain d1keeg2: 1kee G:936-1073 [68517]
    Other proteins in same PDB: d1keea1, d1keea3, d1keea4, d1keea5, d1keea6, d1keeb1, d1keeb2, d1keec1, d1keec3, d1keec4, d1keec5, d1keec6, d1keed1, d1keed2, d1keee1, d1keee3, d1keee4, d1keee5, d1keee6, d1keef1, d1keef2, d1keeg1, d1keeg3, d1keeg4, d1keeg5, d1keeg6, d1keeh1, d1keeh2
    complexed with 143, adp, cl, k, mn, net, orn, pi

Details for d1keeg2

PDB Entry: 1kee (more details), 2.1 Å

PDB Description: inactivation of the amidotransferase activity of carbamoyl phosphate synthetase by the antibiotic acivicin

SCOP Domain Sequences for d1keeg2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1keeg2 c.24.1.1 (G:936-1073) Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain {Escherichia coli}
nstmkkhgrallsvregdkervvdlaakllkqgfeldathgtaivlgeaginprlvnkvh
egrphiqdrikngeytyiinttsgrraiedsrvirrsalqykvhydttlnggfatamaln
adatekvisvqemhaqik

SCOP Domain Coordinates for d1keeg2:

Click to download the PDB-style file with coordinates for d1keeg2.
(The format of our PDB-style files is described here.)

Timeline for d1keeg2: