Lineage for d1keeg1 (1kee G:403-555)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1496944Fold a.92: Carbamoyl phosphate synthetase, large subunit connection domain [48107] (1 superfamily)
    multihelical; consists of two all-alpha subdomains
    possible duplication: subdomains have similar topologies
  4. 1496945Superfamily a.92.1: Carbamoyl phosphate synthetase, large subunit connection domain [48108] (1 family) (S)
    automatically mapped to Pfam PF02787
  5. 1496946Family a.92.1.1: Carbamoyl phosphate synthetase, large subunit connection domain [48109] (1 protein)
  6. 1496947Protein Carbamoyl phosphate synthetase, large subunit connection domain [48110] (1 species)
  7. 1496948Species Escherichia coli [TaxId:562] [48111] (10 PDB entries)
    Uniprot P00968
  8. 1496972Domain d1keeg1: 1kee G:403-555 [68516]
    Other proteins in same PDB: d1keea2, d1keea3, d1keea4, d1keea5, d1keea6, d1keeb1, d1keeb2, d1keec2, d1keec3, d1keec4, d1keec5, d1keec6, d1keed1, d1keed2, d1keee2, d1keee3, d1keee4, d1keee5, d1keee6, d1keef1, d1keef2, d1keeg2, d1keeg3, d1keeg4, d1keeg5, d1keeg6, d1keeh1, d1keeh2
    complexed with adp, cl, k, mn, net, orn, po4

Details for d1keeg1

PDB Entry: 1kee (more details), 2.1 Å

PDB Description: inactivation of the amidotransferase activity of carbamoyl phosphate synthetase by the antibiotic acivicin
PDB Compounds: (G:) Carbamoyl-phosphate synthetase large chain

SCOPe Domain Sequences for d1keeg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1keeg1 a.92.1.1 (G:403-555) Carbamoyl phosphate synthetase, large subunit connection domain {Escherichia coli [TaxId: 562]}
evgatgfdpkvslddpealtkirrelkdagadriwyiadafraglsvdgvfnltnidrwf
lvqieelvrleekvaevgitglnadflrqlkrkgfadarlaklagvreaeirklrdqydl
hpvykrvdtcaaefatdtaymystyeeeceanp

SCOPe Domain Coordinates for d1keeg1:

Click to download the PDB-style file with coordinates for d1keeg1.
(The format of our PDB-style files is described here.)

Timeline for d1keeg1: