SCOP 1.61: Domain d1keef1: 1kee F:2-152

Lineage for d1keef1 (1kee F:2-152)

1. Root: SCOP 1.61

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (5 superfamilies)

4. Superfamily c.8.3: Carbamoyl phosphate synthetase, small subunit N-terminal domain [52021] (1 family)

5. Family c.8.3.1: Carbamoyl phosphate synthetase, small subunit N-terminal domain [52022] (1 protein)

6. Protein Carbamoyl phosphate synthetase, small subunit N-terminal domain [52023] (1 species)

7. Species Escherichia coli [TaxId:562] [52024] (9 PDB entries)

8. Domain d1keef1: 1kee F:2-152 [68514]
   Other proteins in same PDB: d1keea1, d1keea2, d1keea3, d1keea4, d1keea5, d1keea6, d1keeb2, d1keec1, d1keec2, d1keec3, d1keec4, d1keec5, d1keec6, d1keed2, d1keee1, d1keee2, d1keee3, d1keee4, d1keee5, d1keee6, d1keef2, d1keeg1, d1keeg2, d1keeg3, d1keeg4, d1keeg5, d1keeg6, d1keeh2

Details for d1keef1

PDB Entry: 1kee, 2.1 Å

PDB Description: inactivation of the amidotransferase activity of carbamoyl phosphate synthetase by the antibiotic acivicin

SCOP Domain Sequences for d1keef1:

Sequence; same for both SEQRES and ATOM records:

>d1keef1 c.8.3.1 (F:2-152) Carbamoyl phosphate synthetase, small subunit N-terminal domain {Escherichia coli}
iksallvledgtqfhgraigatgsavgevvfntsmtgyqeiltdpsysrqivtltyphig
nvgtndadeessqvhaqglvirdlpliasnfrntedlssylkrhnivaiadidtrkltrl
lrekgaqngciiagdnpdaalalekarafpg

Timeline for d1keef1:

• d1keef1 first appeared in SCOP 1.59
  
• d1keef1 appears in SCOP 1.63
  
• d1keef1 appears in the current release, SCOPe 2.08