SCOP 1.67: Domain d1keed2: 1kee D:153-380

Lineage for d1keed2 (1kee D:153-380)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (5 families)
   conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures

5. Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (7 proteins)
   contains a catalytic Cys-His-Glu triad

6. Protein Carbamoyl phosphate synthetase, small subunit C-terminal domain [52321] (1 species)

7. Species Escherichia coli [TaxId:562] [52322] (9 PDB entries)

8. Domain d1keed2: 1kee D:153-380 [68507]
   Other proteins in same PDB: d1keea1, d1keea2, d1keea3, d1keea4, d1keea5, d1keea6, d1keeb1, d1keec1, d1keec2, d1keec3, d1keec4, d1keec5, d1keec6, d1keed1, d1keee1, d1keee2, d1keee3, d1keee4, d1keee5, d1keee6, d1keef1, d1keeg1, d1keeg2, d1keeg3, d1keeg4, d1keeg5, d1keeg6, d1keeh1

Details for d1keed2

PDB Entry: 1kee, 2.1 Å

PDB Description: inactivation of the amidotransferase activity of carbamoyl phosphate synthetase by the antibiotic acivicin

SCOP Domain Sequences for d1keed2:

Sequence; same for both SEQRES and ATOM records:

>d1keed2 c.23.16.1 (D:153-380) Carbamoyl phosphate synthetase, small subunit C-terminal domain {Escherichia coli}
lngmdlakevttaeayswtqgswtltgglpeakkedelpfhvvaydfgakrnilrmlvdr
gcrltivpaqtsaedvlkmnpdgiflsngpgdpapcdyaitaiqkfletdipvfgiclgh
qllalasgaktvkmkfghhggnhpvkdveknvvmitaqnhgfavdeatlpanlrvthksl
fdgtlqgihrtdkpafsfqghpeaspgphdaaplfdhfielieqyrkt

Timeline for d1keed2:

• d1keed2 first appeared in SCOP 1.59
  
• d1keed2 appears in SCOP 1.65
  
• d1keed2 appears in SCOP 1.69
  
• d1keed2 appears in the current release, SCOPe 2.08