Lineage for d1keeb2 (1kee B:153-380)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 390873Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 391660Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (5 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 391661Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (7 proteins)
    contains a catalytic Cys-His-Glu triad
  6. 391672Protein Carbamoyl phosphate synthetase, small subunit C-terminal domain [52321] (1 species)
  7. 391673Species Escherichia coli [TaxId:562] [52322] (9 PDB entries)
  8. 391698Domain d1keeb2: 1kee B:153-380 [68499]
    Other proteins in same PDB: d1keea1, d1keea2, d1keea3, d1keea4, d1keea5, d1keea6, d1keeb1, d1keec1, d1keec2, d1keec3, d1keec4, d1keec5, d1keec6, d1keed1, d1keee1, d1keee2, d1keee3, d1keee4, d1keee5, d1keee6, d1keef1, d1keeg1, d1keeg2, d1keeg3, d1keeg4, d1keeg5, d1keeg6, d1keeh1

Details for d1keeb2

PDB Entry: 1kee (more details), 2.1 Å

PDB Description: inactivation of the amidotransferase activity of carbamoyl phosphate synthetase by the antibiotic acivicin

SCOP Domain Sequences for d1keeb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1keeb2 c.23.16.1 (B:153-380) Carbamoyl phosphate synthetase, small subunit C-terminal domain {Escherichia coli}
lngmdlakevttaeayswtqgswtltgglpeakkedelpfhvvaydfgakrnilrmlvdr
gcrltivpaqtsaedvlkmnpdgiflsngpgdpapcdyaitaiqkfletdipvfgiclgh
qllalasgaktvkmkfghhggnhpvkdveknvvmitaqnhgfavdeatlpanlrvthksl
fdgtlqgihrtdkpafsfqghpeaspgphdaaplfdhfielieqyrkt

SCOP Domain Coordinates for d1keeb2:

Click to download the PDB-style file with coordinates for d1keeb2.
(The format of our PDB-style files is described here.)

Timeline for d1keeb2: