Lineage for d1keaa_ (1kea A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2334077Fold a.96: DNA-glycosylase [48149] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2334078Superfamily a.96.1: DNA-glycosylase [48150] (7 families) (S)
  5. 2334086Family a.96.1.2: Mismatch glycosylase [48154] (4 proteins)
  6. 2334111Protein Thymine-DNA glycosylase [69081] (1 species)
  7. 2334112Species Methanobacterium thermoautotrophicum [TaxId:145262] [69082] (1 PDB entry)
  8. 2334113Domain d1keaa_: 1kea A: [68491]
    complexed with act, cl, sf4, zn

Details for d1keaa_

PDB Entry: 1kea (more details), 2 Å

PDB Description: structure of a thermostable thymine-dna glycosylase
PDB Compounds: (A:) Possible G-T mismatches repair enzyme

SCOPe Domain Sequences for d1keaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1keaa_ a.96.1.2 (A:) Thymine-DNA glycosylase {Methanobacterium thermoautotrophicum [TaxId: 145262]}
datnkkrkvfvstiltfwntdrrdfpwrhtrdpyviliteillrrttaghvkkiydkffv
kykcfedilktpkseiakdikeiglsnqraeqlkelarvvindyggrvprnrkaildlpg
vgkytcaavmclafgkkaamvdanfvrvinryfggsyenlnynhkalwelaetlvpggkc
rdfnlglmdfsaiicaprkpkcekcgmsklcsyyekc

SCOPe Domain Coordinates for d1keaa_:

Click to download the PDB-style file with coordinates for d1keaa_.
(The format of our PDB-style files is described here.)

Timeline for d1keaa_: