Class a: All alpha proteins [46456] (289 folds) |
Fold a.96: DNA-glycosylase [48149] (1 superfamily) multihelical; consists of two all-alpha domains |
Superfamily a.96.1: DNA-glycosylase [48150] (7 families) |
Family a.96.1.2: Mismatch glycosylase [48154] (4 proteins) |
Protein Thymine-DNA glycosylase [69081] (1 species) |
Species Methanobacterium thermoautotrophicum [TaxId:145262] [69082] (1 PDB entry) |
Domain d1keaa_: 1kea A: [68491] complexed with act, cl, sf4, zn |
PDB Entry: 1kea (more details), 2 Å
SCOPe Domain Sequences for d1keaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1keaa_ a.96.1.2 (A:) Thymine-DNA glycosylase {Methanobacterium thermoautotrophicum [TaxId: 145262]} datnkkrkvfvstiltfwntdrrdfpwrhtrdpyviliteillrrttaghvkkiydkffv kykcfedilktpkseiakdikeiglsnqraeqlkelarvvindyggrvprnrkaildlpg vgkytcaavmclafgkkaamvdanfvrvinryfggsyenlnynhkalwelaetlvpggkc rdfnlglmdfsaiicaprkpkcekcgmsklcsyyekc
Timeline for d1keaa_: