Lineage for d1keaa_ (1kea A:)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 155109Fold a.96: DNA-glycosylase [48149] (1 superfamily)
  4. 155110Superfamily a.96.1: DNA-glycosylase [48150] (4 families) (S)
  5. 155115Family a.96.1.2: Mismatch glycosylase [48154] (2 proteins)
  6. 155122Protein Thymine-DNA glycosylase [69081] (1 species)
  7. 155123Species Archaeon Methanobacterium thermoformicicum [TaxId:145262] [69082] (1 PDB entry)
  8. 155124Domain d1keaa_: 1kea A: [68491]

Details for d1keaa_

PDB Entry: 1kea (more details), 2 Å

PDB Description: structure of a thermostable thymine-dna glycosylase

SCOP Domain Sequences for d1keaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1keaa_ a.96.1.2 (A:) Thymine-DNA glycosylase {Archaeon Methanobacterium thermoformicicum}
datnkkrkvfvstiltfwntdrrdfpwrhtrdpyviliteillrrttaghvkkiydkffv
kykcfedilktpkseiakdikeiglsnqraeqlkelarvvindyggrvprnrkaildlpg
vgkytcaavmclafgkkaamvdanfvrvinryfggsyenlnynhkalwelaetlvpggkc
rdfnlglmdfsaiicaprkpkcekcgmsklcsyyekc

SCOP Domain Coordinates for d1keaa_:

Click to download the PDB-style file with coordinates for d1keaa_.
(The format of our PDB-style files is described here.)

Timeline for d1keaa_: