Lineage for d1kdtb_ (1kdt B:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 695085Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 695086Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 695087Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (20 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 695151Protein CMP kinase [52548] (2 species)
  7. 695152Species Escherichia coli [TaxId:562] [52549] (6 PDB entries)
  8. 695157Domain d1kdtb_: 1kdt B: [68485]
    complexed with doc, so4

Details for d1kdtb_

PDB Entry: 1kdt (more details), 1.95 Å

PDB Description: cytidine monophosphate kinase from e.coli in complex with 2',3'-dideoxy-cytidine monophosphate
PDB Compounds: (B:) Cytidylate kinase

SCOP Domain Sequences for d1kdtb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kdtb_ c.37.1.1 (B:) CMP kinase {Escherichia coli [TaxId: 562]}
aiapvitidgpsgagkgtlckamaealqwhlldsgaiyrvlalaalhhhvdvasedalvp
lashldvrfvstngnlevilegedvsgeirtqevanaasqvaafprvreallrrqrafre
lpgliadgrdmgtvvfpdapvkifldasseerahrrmlqlqekgfsvnferllaeikerd
drdrnravaplvpaadalvldsttlsieqviekalqyarqkla

SCOP Domain Coordinates for d1kdtb_:

Click to download the PDB-style file with coordinates for d1kdtb_.
(The format of our PDB-style files is described here.)

Timeline for d1kdtb_: