Lineage for d1kdtb_ (1kdt B:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 121667Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 121668Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (16 families) (S)
  5. 121669Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (12 proteins)
  6. 121712Protein CMP kinase [52548] (1 species)
  7. 121713Species Escherichia coli [TaxId:562] [52549] (6 PDB entries)
  8. 121718Domain d1kdtb_: 1kdt B: [68485]

Details for d1kdtb_

PDB Entry: 1kdt (more details), 1.95 Å

PDB Description: cytidine monophosphate kinase from e.coli in complex with 2',3'-dideoxy-cytidine monophosphate

SCOP Domain Sequences for d1kdtb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kdtb_ c.37.1.1 (B:) CMP kinase {Escherichia coli}
aiapvitidgpsgagkgtlckamaealqwhlldsgaiyrvlalaalhhhvdvasedalvp
lashldvrfvstngnlevilegedvsgeirtqevanaasqvaafprvreallrrqrafre
lpgliadgrdmgtvvfpdapvkifldasseerahrrmlqlqekgfsvnferllaeikerd
drdrnravaplvpaadalvldsttlsieqviekalqyarqkla

SCOP Domain Coordinates for d1kdtb_:

Click to download the PDB-style file with coordinates for d1kdtb_.
(The format of our PDB-style files is described here.)

Timeline for d1kdtb_: