Lineage for d1kdra_ (1kdr A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2123294Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 2123367Protein CMP kinase [52548] (3 species)
  7. 2123368Species Escherichia coli [TaxId:562] [52549] (6 PDB entries)
  8. 2123377Domain d1kdra_: 1kdr A: [68482]
    complexed with car, so4

Details for d1kdra_

PDB Entry: 1kdr (more details), 2.25 Å

PDB Description: cytidine monophosphate kinase from e.coli in complex with ara-cytidine monophosphate
PDB Compounds: (A:) Cytidylate kinase

SCOPe Domain Sequences for d1kdra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kdra_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]}
aiapvitidgpsgagkgtlckamaealqwhlldsgaiyrvlalaalhhhvdvasedalvp
lashldvrfvstngnlevilegedvsgeirtqevanaasqvaafprvreallrrqrafre
lpgliadgrdmgtvvfpdapvkifldasseerahrrmlqlqekgfsvnferllaeikerd
drdrnravaplvpaadalvldsttlsieqviekalqyarqk

SCOPe Domain Coordinates for d1kdra_:

Click to download the PDB-style file with coordinates for d1kdra_.
(The format of our PDB-style files is described here.)

Timeline for d1kdra_: