Lineage for d1kdra_ (1kdr A:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 581392Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 581393Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (23 families) (S)
    division into families based on beta-sheet topologies
  5. 581394Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (18 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 581453Protein CMP kinase [52548] (2 species)
  7. 581454Species Escherichia coli [TaxId:562] [52549] (6 PDB entries)
  8. 581463Domain d1kdra_: 1kdr A: [68482]

Details for d1kdra_

PDB Entry: 1kdr (more details), 2.25 Å

PDB Description: cytidine monophosphate kinase from e.coli in complex with ara-cytidine monophosphate

SCOP Domain Sequences for d1kdra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kdra_ c.37.1.1 (A:) CMP kinase {Escherichia coli}
aiapvitidgpsgagkgtlckamaealqwhlldsgaiyrvlalaalhhhvdvasedalvp
lashldvrfvstngnlevilegedvsgeirtqevanaasqvaafprvreallrrqrafre
lpgliadgrdmgtvvfpdapvkifldasseerahrrmlqlqekgfsvnferllaeikerd
drdrnravaplvpaadalvldsttlsieqviekalqyarqk

SCOP Domain Coordinates for d1kdra_:

Click to download the PDB-style file with coordinates for d1kdra_.
(The format of our PDB-style files is described here.)

Timeline for d1kdra_: