Lineage for d1kdpa_ (1kdp A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1845074Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 1845145Protein CMP kinase [52548] (3 species)
  7. 1845146Species Escherichia coli [TaxId:562] [52549] (6 PDB entries)
  8. 1845153Domain d1kdpa_: 1kdp A: [68480]
    complexed with c, so4

Details for d1kdpa_

PDB Entry: 1kdp (more details), 2.3 Å

PDB Description: cytidine monophosphate kinase from e. coli in complex with 2'-deoxy-cytidine monophosphate
PDB Compounds: (A:) Cytidylate kinase

SCOPe Domain Sequences for d1kdpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kdpa_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]}
aiapvitidgpsgagkgtlckamaealqwhlldsgaiyrvlalaalhhhvdvasedalvp
lashldvrfvstngnlevilegedvsgeirtqevanaasqvaafprvreallrrqrafre
lpgliadgrdmgtvvfpdapvkifldasseerahrrmlqlqekgfsvnferllaeikerd
drdrnravaplvpaadalvldsttlsieqviekalqyarqkla

SCOPe Domain Coordinates for d1kdpa_:

Click to download the PDB-style file with coordinates for d1kdpa_.
(The format of our PDB-style files is described here.)

Timeline for d1kdpa_: