SCOPe 2.04: Domain d1kdob_: 1kdo B:

Lineage for d1kdob_ (1kdo B:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
   parallel beta-sheet of 5 strands, order 23145

6. Protein CMP kinase [52548] (3 species)

7. Species Escherichia coli [TaxId:562] [52549] (6 PDB entries)

8. Domain d1kdob_: 1kdo B: [68479]
   complexed with c, so4

Details for d1kdob_

PDB Entry: 1kdo, 1.9 Å

PDB Description: cytidine monophosphate kinase from e. coli in complex with cytidine monophosphate

PDB Compounds: (B:) Cytidylate kinase

SCOPe Domain Sequences for d1kdob_:

Sequence; same for both SEQRES and ATOM records:

>d1kdob_ c.37.1.1 (B:) CMP kinase {Escherichia coli [TaxId: 562]}
aiapvitidgpsgagkgtlckamaealqwhlldsgaiyrvlalaalhhhvdvasedalvp
lashldvrfvstngnlevilegedvsgeirtqevanaasqvaafprvreallrrqrafre
lpgliadgrdmgtvvfpdapvkifldasseerahrrmlqlqekgfsvnferllaeikerd
drdrnravaplvpaadalvldsttlsieqviekalqyarqkla

Timeline for d1kdob_:

• d1kdob_ first appeared in SCOP 1.59
  
• d1kdob_ appears in SCOPe 2.03
  
• d1kdob_ appears in SCOPe 2.05
  
• d1kdob_ appears in the current release, SCOPe 2.08