Lineage for d1kdob_ (1kdo B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2865685Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 2865762Protein CMP kinase [52548] (3 species)
  7. 2865763Species Escherichia coli [TaxId:562] [52549] (6 PDB entries)
  8. 2865771Domain d1kdob_: 1kdo B: [68479]
    complexed with c, so4

Details for d1kdob_

PDB Entry: 1kdo (more details), 1.9 Å

PDB Description: cytidine monophosphate kinase from e. coli in complex with cytidine monophosphate
PDB Compounds: (B:) Cytidylate kinase

SCOPe Domain Sequences for d1kdob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kdob_ c.37.1.1 (B:) CMP kinase {Escherichia coli [TaxId: 562]}
aiapvitidgpsgagkgtlckamaealqwhlldsgaiyrvlalaalhhhvdvasedalvp
lashldvrfvstngnlevilegedvsgeirtqevanaasqvaafprvreallrrqrafre
lpgliadgrdmgtvvfpdapvkifldasseerahrrmlqlqekgfsvnferllaeikerd
drdrnravaplvpaadalvldsttlsieqviekalqyarqkla

SCOPe Domain Coordinates for d1kdob_:

Click to download the PDB-style file with coordinates for d1kdob_.
(The format of our PDB-style files is described here.)

Timeline for d1kdob_: