Lineage for d1kdoa_ (1kdo A:)
- Root: SCOP 1.61
Class c: Alpha and beta proteins (a/b) [51349] (117 folds) 
Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (18 families) 
Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (15 proteins) 
Protein CMP kinase [52548] (1 species) Species Escherichia coli [TaxId:562] [52549] (6 PDB entries) 
Domain d1kdoa_: 1kdo A: [68478]
Details for d1kdoa_
PDB Entry: 1kdo (more details), 1.9 Å
PDB Description: cytidine monophosphate kinase from e. coli in complex with cytidine monophosphate
SCOP Domain Sequences for d1kdoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kdoa_ c.37.1.1 (A:) CMP kinase {Escherichia coli}
aiapvitidgpsgagkgtlckamaealqwhlldsgaiyrvlalaalhhhvdvasedalvp
lashldvrfvstngnlevilegedvsgeirtqevanaasqvaafprvreallrrqrafre
lpgliadgrdmgtvvfpdapvkifldasseerahrrmlqlqekgfsvnferllaeikerd
drdrnravaplvpaadalvldsttlsieqviekalqyarqkla
SCOP Domain Coordinates for d1kdoa_:
Click to download the PDB-style file with coordinates for d1kdoa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1kdoa_:
- d1kdoa_ first appeared in SCOP 1.59
- d1kdoa_ appears in SCOP 1.63
- d1kdoa_ appears in the current release, SCOPe 2.08
View in 3D
