Lineage for d1kd6a_ (1kd6 A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2085444Fold b.97: Cytolysin/lectin [63723] (1 superfamily)
    sandwich, 10 strands in 2 sheets;
  4. 2085445Superfamily b.97.1: Cytolysin/lectin [63724] (2 families) (S)
    some topological similarity to osmotin
  5. 2085446Family b.97.1.1: Anemone pore-forming cytolysin [63725] (3 proteins)
    Pfam PF06369
  6. 2085447Protein Equinatoxin II (eqtII, tenebrosin C) [63726] (1 species)
  7. 2085448Species European sea anemone (Actinia equina) [TaxId:6106] [63727] (3 PDB entries)
    Uniprot P61914 40-214
  8. 2085452Domain d1kd6a_: 1kd6 A: [68459]

Details for d1kd6a_

PDB Entry: 1kd6 (more details)

PDB Description: solution structure of the eukaryotic pore-forming cytolysin equinatoxin ii
PDB Compounds: (A:) equinatoxin II

SCOPe Domain Sequences for d1kd6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kd6a_ b.97.1.1 (A:) Equinatoxin II (eqtII, tenebrosin C) {European sea anemone (Actinia equina) [TaxId: 6106]}
sadvagavidgaslsfdilktvlealgnvkrkiavgvdnesgktwtalntyfrsgtsdiv
lphkvphgkallyngqkdrgpvatgavgvlaylmsdgntlavlfsvpydynwysnwwnvr
iykgkrradqrmyeelyynlspfrgdngwhtrnlgyglksrgfmnssghaileihvtka

SCOPe Domain Coordinates for d1kd6a_:

Click to download the PDB-style file with coordinates for d1kd6a_.
(The format of our PDB-style files is described here.)

Timeline for d1kd6a_: