Lineage for d1kd6a_ (1kd6 A:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 115785Fold b.97: Equinatoxin II (eqtII, tenebrosin C) [63723] (1 superfamily)
  4. 115786Superfamily b.97.1: Equinatoxin II (eqtII, tenebrosin C) [63724] (1 family) (S)
  5. 115787Family b.97.1.1: Equinatoxin II (eqtII, tenebrosin C) [63725] (1 protein)
  6. 115788Protein Equinatoxin II (eqtII, tenebrosin C) [63726] (1 species)
  7. 115789Species European sea anemone (Actinia equina) [TaxId:6106] [63727] (2 PDB entries)
  8. 115792Domain d1kd6a_: 1kd6 A: [68459]

Details for d1kd6a_

PDB Entry: 1kd6 (more details)

PDB Description: Solution structure of the eukaryotic pore-forming cytolysin equinatoxin II

SCOP Domain Sequences for d1kd6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kd6a_ b.97.1.1 (A:) Equinatoxin II (eqtII, tenebrosin C) {European sea anemone (Actinia equina)}
sadvagavidgaslsfdilktvlealgnvkrkiavgvdnesgktwtalntyfrsgtsdiv
lphkvphgkallyngqkdrgpvatgavgvlaylmsdgntlavlfsvpydynwysnwwnvr
iykgkrradqrmyeelyynlspfrgdngwhtrnlgyglksrgfmnssghaileihvtka

SCOP Domain Coordinates for d1kd6a_:

Click to download the PDB-style file with coordinates for d1kd6a_.
(The format of our PDB-style files is described here.)

Timeline for d1kd6a_: