Lineage for d1kd0b1 (1kd0 B:161-413)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 115904Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies)
  4. 117274Superfamily c.1.11: Enolase C-terminal domain-like [51604] (2 families) (S)
  5. 117301Family c.1.11.2: D-glucarate dehydratase-like [51609] (7 proteins)
  6. 117302Protein beta-Methylaspartase [69400] (2 species)
  7. 117308Species Clostridium tetanomorphum [TaxId:1553] [69401] (2 PDB entries)
  8. 117312Domain d1kd0b1: 1kd0 B:161-413 [68457]
    Other proteins in same PDB: d1kd0a2, d1kd0b2

Details for d1kd0b1

PDB Entry: 1kd0 (more details), 1.9 Å

PDB Description: Crystal Structure of beta-methylaspartase from Clostridium tetanomorphum. Apo-structure.
PDB Compounds: (B:)

SCOP Domain Sequences for d1kd0b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kd0b1 c.1.11.2 (B:161-413) beta-Methylaspartase {Clostridium tetanomorphum}
gaeinavpvfaqsgddrydnvdkmiikeadvlphalinnveeklglkgeklleyvkwlrd
riiklrvredyapifhidvygtigaafdvdikamadyiqtlaeaakpfhlriegpmdved
rqkqmeamrdlraeldgrgvdaelvadewcntvedvkfftdnkaghmvqiktpdlggvnn
iadaimyckangmgaycggtcnetnrsaevttnigmacgarqvlakpgmgvdegmmivkn
emnrvlalvgrrk

SCOP Domain Coordinates for d1kd0b1:

Click to download the PDB-style file with coordinates for d1kd0b1.
(The format of our PDB-style files is described here.)

Timeline for d1kd0b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kd0b2