Lineage for d1kd0a2 (1kd0 A:1-160)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 133144Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
  4. 133145Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family) (S)
  5. 133146Family d.54.1.1: Enolase N-terminal domain-like [54827] (8 proteins)
  6. 133147Protein beta-Methylaspartase [69714] (2 species)
  7. 133153Species Clostridium tetanomorphum [TaxId:1553] [69715] (2 PDB entries)
  8. 133156Domain d1kd0a2: 1kd0 A:1-160 [68456]
    Other proteins in same PDB: d1kd0a1, d1kd0b1

Details for d1kd0a2

PDB Entry: 1kd0 (more details), 1.9 Å

PDB Description: Crystal Structure of beta-methylaspartase from Clostridium tetanomorphum. Apo-structure.

SCOP Domain Sequences for d1kd0a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kd0a2 d.54.1.1 (A:1-160) beta-Methylaspartase {Clostridium tetanomorphum}
mkivdvlctpgltgfyfddqraikkgaghdgftytgstvtegftqvrqkgesisvllvle
dgqvahgdcaavqysgaggrdplflakdfipviekeiapkligreitnfkpmaeefdkmt
vngnrlhtairygitqaildavaktrkvtmaevirdeynp

SCOP Domain Coordinates for d1kd0a2:

Click to download the PDB-style file with coordinates for d1kd0a2.
(The format of our PDB-style files is described here.)

Timeline for d1kd0a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kd0a1