Lineage for d1kczb1 (1kcz B:161-413)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 172678Fold c.1: TIM beta/alpha-barrel [51350] (25 superfamilies)
  4. 174266Superfamily c.1.11: Enolase C-terminal domain-like [51604] (2 families) (S)
  5. 174297Family c.1.11.2: D-glucarate dehydratase-like [51609] (7 proteins)
  6. 174298Protein beta-Methylaspartase [69400] (2 species)
  7. 174304Species Clostridium tetanomorphum [TaxId:1553] [69401] (2 PDB entries)
  8. 174306Domain d1kczb1: 1kcz B:161-413 [68453]
    Other proteins in same PDB: d1kcza2, d1kczb2

Details for d1kczb1

PDB Entry: 1kcz (more details), 1.9 Å

PDB Description: Crystal Structure of beta-methylaspartase from Clostridium tetanomorphum. Mg-complex.
PDB Compounds: (B:)

SCOP Domain Sequences for d1kczb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kczb1 c.1.11.2 (B:161-413) beta-Methylaspartase {Clostridium tetanomorphum}
gaeinavpvfaqsgddrydnvdkmiikeadvlphalinnveeklglkgeklleyvkwlrd
riiklrvredyapifhidvygtigaafdvdikamadyiqtlaeaakpfhlriegpmdved
rqkqmeamrdlraeldgrgvdaelvadewcntvedvkfftdnkaghmvqiktpdlggvnn
iadaimyckangmgaycggtcnetnrsaevttnigmacgarqvlakpgmgvdegmmivkn
emnrvlalvgrrk

SCOP Domain Coordinates for d1kczb1:

Click to download the PDB-style file with coordinates for d1kczb1.
(The format of our PDB-style files is described here.)

Timeline for d1kczb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kczb2