SCOPe 2.05: Domain d1kcka2: 1kck A:582-686

Lineage for d1kcka2 (1kck A:582-686)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.3: Prealbumin-like [49451] (7 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.1: Starch-binding domain-like [49452] (4 families)

5. Family b.3.1.1: Starch-binding domain [49453] (3 proteins)
   automatically mapped to Pfam PF00686

6. Protein Cyclodextrin glycosyltransferase, C-terminal domain [49454] (5 species)
   this domain is the last one in the protein chain

7. Species Bacillus circulans, different strains [TaxId:1397] [49455] (36 PDB entries)

8. Domain d1kcka2: 1kck A:582-686 [68442]
   Other proteins in same PDB: d1kcka1, d1kcka3, d1kcka4
   complexed with adh, ca, glc; mutant

Details for d1kcka2

PDB Entry: 1kck, 2.43 Å

PDB Description: bacillus circulans strain 251 cyclodextrin glycosyl transferase mutant n193g

PDB Compounds: (A:) cyclodextrin glycosyltransferase

SCOPe Domain Sequences for d1kcka2:

Sequence; same for both SEQRES and ATOM records:

>d1kcka2 b.3.1.1 (A:582-686) Cyclodextrin glycosyltransferase, C-terminal domain {Bacillus circulans, different strains [TaxId: 1397]}
lsgdqvsvrfvvnnattalgqnvyltgsvselgnwdpakaigpmynqvvyqypnwyydvs
vpagktiefkflkkqgstvtweggsnhtftapssgtatinvnwqp

Timeline for d1kcka2:

• d1kcka2 first appeared in SCOP 1.59
  
• d1kcka2 appears in SCOPe 2.04
  
• d1kcka2 appears in SCOPe 2.06
  
• d1kcka2 appears in the current release, SCOPe 2.08