Lineage for d1kcka1 (1kck A:496-581)
- Root: SCOP 1.61
Class b: All beta proteins [48724] (111 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies) 
Superfamily b.1.1: Immunoglobulin [48726] (6 families) 
Family b.1.1.5: E set domains [49208] (27 proteins) 
Protein Cyclodextrin glycosyltransferase, domain E [49215] (5 species) 
Species Bacillus circulans, different strains [TaxId:1397] [49216] (29 PDB entries) 
Domain d1kcka1: 1kck A:496-581 [68441]
Other proteins in same PDB: d1kcka2, d1kcka3, d1kcka4
Details for d1kcka1
PDB Entry: 1kck (more details), 2.43 Å
PDB Description: bacillus circulans strain 251 cyclodextrin glycosyl transferase mutant n193g
SCOP Domain Sequences for d1kcka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kcka1 b.1.1.5 (A:496-581) Cyclodextrin glycosyltransferase, domain E {Bacillus circulans, different strains}
tatptighvgpmmakpgvtitidgrgfgsskgtvyfgttavsgaditswedtqikvkipa
vaggnynikvanaagtasnvydnfev
SCOP Domain Coordinates for d1kcka1:
Click to download the PDB-style file with coordinates for d1kcka1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1kcka1:
- d1kcka1 first appeared in SCOP 1.59
- d1kcka1 appears in SCOP 1.63
- d1kcka1 appears in the current release, SCOPe 2.08
View in 3D
