Lineage for d1kcga_ (1kcg A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1442549Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 1442550Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 1442551Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 1442812Protein NK cell-activating receptor nkg2d [64453] (2 species)
  7. 1442813Species Human (Homo sapiens) [TaxId:9606] [64455] (3 PDB entries)
  8. 1442814Domain d1kcga_: 1kcg A: [68438]
    Other proteins in same PDB: d1kcgc_
    complexed with gsh

Details for d1kcga_

PDB Entry: 1kcg (more details), 2.6 Å

PDB Description: NKG2D in complex with ULBP3
PDB Compounds: (A:) nkg2-d type II integral membrane protein

SCOPe Domain Sequences for d1kcga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kcga_ d.169.1.1 (A:) NK cell-activating receptor nkg2d {Human (Homo sapiens) [TaxId: 9606]}
sycgpcpknwicyknncyqffdesknwyesqascmsqnasllkvyskedqdllklvksyh
wmglvhiptngswqwedgsilspnlltiiemqkgdcalyassfkgyiencstpntyicmq
rt

SCOPe Domain Coordinates for d1kcga_:

Click to download the PDB-style file with coordinates for d1kcga_.
(The format of our PDB-style files is described here.)

Timeline for d1kcga_: