Lineage for d1kcfb2 (1kcf B:39-256)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 124260Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
  4. 124495Superfamily c.55.3: Ribonuclease H-like [53098] (7 families) (S)
  5. 124751Family c.55.3.7: Mitochondrial resolvase ydc2 catalytic domain [69533] (1 protein)
  6. 124752Protein Mitochondrial resolvase ydc2 catalytic domain [69534] (1 species)
  7. 124753Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [69535] (1 PDB entry)
  8. 124755Domain d1kcfb2: 1kcf B:39-256 [68437]
    Other proteins in same PDB: d1kcfa1, d1kcfb1

Details for d1kcfb2

PDB Entry: 1kcf (more details), 2.3 Å

PDB Description: Crystal Structure of the Yeast Mitochondrial Holliday Junction Resolvase, Ydc2

SCOP Domain Sequences for d1kcfb2:

Sequence, based on SEQRES records: (download)

>d1kcfb2 c.55.3.7 (B:39-256) Mitochondrial resolvase ydc2 catalytic domain {Fission yeast (Schizosaccharomyces pombe)}
tsrvlgidlgiknfsycfasqnedskviihnwsvenltekngldiqwtedfqpssmadls
iqlfntlhekfnphvilmerqryrsgiatipewtlrvnmlesmlyalhyaekrnsieqki
qypfllslspkstysywasvlntkasfskkksrvqmvkelidgqkilfeneealykwnng
srvefkkddmadsaliasgwmrwqaqlkhyrnfckqfl

Sequence, based on observed residues (ATOM records): (download)

>d1kcfb2 c.55.3.7 (B:39-256) Mitochondrial resolvase ydc2 catalytic domain {Fission yeast (Schizosaccharomyces pombe)}
tsrvlgidlgiknfsycfasqnedskviihnwsvenltekngldiqwtedfqpssmadls
iqlfntlhekfnphvilmerqryewtlrvnmlesmlyalhyaekrnsieqkiqypfllsl
spkstysywasvlnsrvqmvkelidgqkilfeneealykwnngefkkddmadsaliasgw
mrwqaqlkhyrnfckqfl

SCOP Domain Coordinates for d1kcfb2:

Click to download the PDB-style file with coordinates for d1kcfb2.
(The format of our PDB-style files is described here.)

Timeline for d1kcfb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kcfb1