SCOPe 2.07: Domain d1kcfb1: 1kcf B:5-38

Lineage for d1kcfb1 (1kcf B:5-38)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.140: LEM/SAP HeH motif [63450] (6 superfamilies)
   helix-extended loop-helix; parallel helices

4. Superfamily a.140.2: SAP domain [68906] (1 family)

5. Family a.140.2.1: SAP domain [68907] (8 proteins)
   Pfam PF02037

6. Protein Mitochondrial resolvase ydc2 N-terminal domain [68945] (1 species)

7. Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [68946] (1 PDB entry)

8. Domain d1kcfb1: 1kcf B:5-38 [68436]
   Other proteins in same PDB: d1kcfa2, d1kcfb2
   complexed with so4

Details for d1kcfb1

PDB Entry: 1kcf, 2.3 Å

PDB Description: Crystal Structure of the Yeast Mitochondrial Holliday Junction Resolvase, Ydc2

PDB Compounds: (B:) hypothetical 30.2 kd protein c25g10.02 in chromosome I

SCOPe Domain Sequences for d1kcfb1:

Sequence, based on SEQRES records:

>d1kcfb1 a.140.2.1 (B:5-38) Mitochondrial resolvase ydc2 N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
klsflqhickltglsrsgrkdellrrivdspiyp

Sequence, based on observed residues (ATOM records):

>d1kcfb1 a.140.2.1 (B:5-38) Mitochondrial resolvase ydc2 N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
klsflqhickltglsrsellrrivdspiyp

Timeline for d1kcfb1:

• d1kcfb1 first appeared in SCOP 1.59
  
• d1kcfb1 appears in SCOPe 2.06
  
• d1kcfb1 appears in the current release, SCOPe 2.08