Lineage for d1kcfb1 (1kcf B:5-38)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2012958Fold a.140: LEM/SAP HeH motif [63450] (6 superfamilies)
    helix-extended loop-helix; parallel helices
  4. 2012972Superfamily a.140.2: SAP domain [68906] (1 family) (S)
  5. 2012973Family a.140.2.1: SAP domain [68907] (8 protein domains)
    Pfam PF02037
  6. 2012981Protein Mitochondrial resolvase ydc2 N-terminal domain [68945] (1 species)
  7. 2012982Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [68946] (1 PDB entry)
  8. 2012984Domain d1kcfb1: 1kcf B:5-38 [68436]
    Other proteins in same PDB: d1kcfa2, d1kcfb2
    complexed with so4

Details for d1kcfb1

PDB Entry: 1kcf (more details), 2.3 Å

PDB Description: Crystal Structure of the Yeast Mitochondrial Holliday Junction Resolvase, Ydc2
PDB Compounds: (B:) hypothetical 30.2 kd protein c25g10.02 in chromosome I

SCOPe Domain Sequences for d1kcfb1:

Sequence, based on SEQRES records: (download)

>d1kcfb1 a.140.2.1 (B:5-38) Mitochondrial resolvase ydc2 N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
klsflqhickltglsrsgrkdellrrivdspiyp

Sequence, based on observed residues (ATOM records): (download)

>d1kcfb1 a.140.2.1 (B:5-38) Mitochondrial resolvase ydc2 N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
klsflqhickltglsrsellrrivdspiyp

SCOPe Domain Coordinates for d1kcfb1:

Click to download the PDB-style file with coordinates for d1kcfb1.
(The format of our PDB-style files is described here.)

Timeline for d1kcfb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kcfb2