Lineage for d1kcfa2 (1kcf A:39-256)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2491249Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2493668Superfamily c.55.3: Ribonuclease H-like [53098] (16 families) (S)
    consists of one domain of this fold
  5. 2494770Family c.55.3.7: Mitochondrial resolvase ydc2 catalytic domain [69533] (1 protein)
    automatically mapped to Pfam PF09159
  6. 2494771Protein Mitochondrial resolvase ydc2 catalytic domain [69534] (1 species)
  7. 2494772Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [69535] (1 PDB entry)
  8. 2494773Domain d1kcfa2: 1kcf A:39-256 [68435]
    Other proteins in same PDB: d1kcfa1, d1kcfb1
    complexed with so4

Details for d1kcfa2

PDB Entry: 1kcf (more details), 2.3 Å

PDB Description: Crystal Structure of the Yeast Mitochondrial Holliday Junction Resolvase, Ydc2
PDB Compounds: (A:) hypothetical 30.2 kd protein c25g10.02 in chromosome I

SCOPe Domain Sequences for d1kcfa2:

Sequence, based on SEQRES records: (download)

>d1kcfa2 c.55.3.7 (A:39-256) Mitochondrial resolvase ydc2 catalytic domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
tsrvlgidlgiknfsycfasqnedskviihnwsvenltekngldiqwtedfqpssmadls
iqlfntlhekfnphvilmerqryrsgiatipewtlrvnmlesmlyalhyaekrnsieqki
qypfllslspkstysywasvlntkasfskkksrvqmvkelidgqkilfeneealykwnng
srvefkkddmadsaliasgwmrwqaqlkhyrnfckqfl

Sequence, based on observed residues (ATOM records): (download)

>d1kcfa2 c.55.3.7 (A:39-256) Mitochondrial resolvase ydc2 catalytic domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
tsrvlgidlgiknfsycfasqnedskviihnwsvenltekngldiqwtedfqpssmadls
iqlfntlhekfnphvilmerqryrsgiatipewtlrvnmlesmlyalhyaekrnypflls
lspkstysywasvlnkksrvqmvkelidgqkilfeneealykwnngsrvefkkddmadsa
liasgwmrwqaqlkhyrnfckqfl

SCOPe Domain Coordinates for d1kcfa2:

Click to download the PDB-style file with coordinates for d1kcfa2.
(The format of our PDB-style files is described here.)

Timeline for d1kcfa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kcfa1