Lineage for d1kcfa1 (1kcf A:3-38)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 101768Fold a.140: LEM/SAP HeH motif [63450] (4 superfamilies)
  4. 101778Superfamily a.140.2: SAP domain [68906] (1 family) (S)
  5. 101779Family a.140.2.1: SAP domain [68907] (2 proteins)
  6. 101784Protein Mitochondrial resolvase ydc2 N-terminal domain [68945] (1 species)
  7. 101785Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [68946] (1 PDB entry)
  8. 101786Domain d1kcfa1: 1kcf A:3-38 [68434]
    Other proteins in same PDB: d1kcfa2, d1kcfb2

Details for d1kcfa1

PDB Entry: 1kcf (more details), 2.3 Å

PDB Description: Crystal Structure of the Yeast Mitochondrial Holliday Junction Resolvase, Ydc2

SCOP Domain Sequences for d1kcfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kcfa1 a.140.2.1 (A:3-38) Mitochondrial resolvase ydc2 N-terminal domain {Fission yeast (Schizosaccharomyces pombe)}
tvklsflqhickltglsrsgrkdellrrivdspiyp

SCOP Domain Coordinates for d1kcfa1:

Click to download the PDB-style file with coordinates for d1kcfa1.
(The format of our PDB-style files is described here.)

Timeline for d1kcfa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kcfa2