![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
![]() | Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) ![]() |
![]() | Family d.142.1.5: Pyruvate phosphate dikinase, N-terminal domain [56085] (2 proteins) automatically mapped to Pfam PF01326 |
![]() | Protein Pyruvate phosphate dikinase, N-terminal domain [56086] (3 species) the common fold is interrupted by a 4-helical subdomain (residues 112-198) |
![]() | Species Clostridium symbiosum [TaxId:1512] [56087] (7 PDB entries) |
![]() | Domain d1kc7a3: 1kc7 A:2-376 [68425] Other proteins in same PDB: d1kc7a1, d1kc7a2 complexed with mg, ppr, so4 |
PDB Entry: 1kc7 (more details), 2.2 Å
SCOPe Domain Sequences for d1kc7a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kc7a3 d.142.1.5 (A:2-376) Pyruvate phosphate dikinase, N-terminal domain {Clostridium symbiosum [TaxId: 1512]} akwvykfeegnasmrnllggkgcnlaemtilgmpipqgftvtteacteyynsgkqitqei qdqifeaitwleelngkkfgdtedpllvsvrsgarasmpgmmdtilnlglndvavegfak ktgnprfaydsyrrfiqmysdvvmevpkshfekiidamkeekgvhfdtdltaddlkelae kfkavykeamngeefpqepkdqlmgavkavfrswdnpraivyrrmndipgdwgtavnvqt mvfgnkgetsgtgvaftrnpstgekgiygeylinaqgedvvagvrtpqpitqlendmpdc ykqfmdlamklekhfrdmqdmeftieegklyflqtrngkrtapaalqiacdlvdegmite eeavvrieaksldql
Timeline for d1kc7a3: