Lineage for d1kc7a3 (1kc7 A:2-376)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2217268Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2217269Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. 2217544Family d.142.1.5: Pyruvate phosphate dikinase, N-terminal domain [56085] (2 proteins)
    automatically mapped to Pfam PF01326
  6. 2217545Protein Pyruvate phosphate dikinase, N-terminal domain [56086] (3 species)
    the common fold is interrupted by a 4-helical subdomain (residues 112-198)
  7. 2217546Species Clostridium symbiosum [TaxId:1512] [56087] (7 PDB entries)
  8. 2217548Domain d1kc7a3: 1kc7 A:2-376 [68425]
    Other proteins in same PDB: d1kc7a1, d1kc7a2
    complexed with mg, ppr, so4

Details for d1kc7a3

PDB Entry: 1kc7 (more details), 2.2 Å

PDB Description: Pyruvate Phosphate Dikinase with Bound Mg-phosphonopyruvate
PDB Compounds: (A:) pyruvate phosphate dikinase

SCOPe Domain Sequences for d1kc7a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kc7a3 d.142.1.5 (A:2-376) Pyruvate phosphate dikinase, N-terminal domain {Clostridium symbiosum [TaxId: 1512]}
akwvykfeegnasmrnllggkgcnlaemtilgmpipqgftvtteacteyynsgkqitqei
qdqifeaitwleelngkkfgdtedpllvsvrsgarasmpgmmdtilnlglndvavegfak
ktgnprfaydsyrrfiqmysdvvmevpkshfekiidamkeekgvhfdtdltaddlkelae
kfkavykeamngeefpqepkdqlmgavkavfrswdnpraivyrrmndipgdwgtavnvqt
mvfgnkgetsgtgvaftrnpstgekgiygeylinaqgedvvagvrtpqpitqlendmpdc
ykqfmdlamklekhfrdmqdmeftieegklyflqtrngkrtapaalqiacdlvdegmite
eeavvrieaksldql

SCOPe Domain Coordinates for d1kc7a3:

Click to download the PDB-style file with coordinates for d1kc7a3.
(The format of our PDB-style files is described here.)

Timeline for d1kc7a3: