Lineage for d1kc7a2 (1kc7 A:377-509)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1155496Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies)
    3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
    this domain is thought to be mobile in most multi-domain proteins known to contain it
  4. 1155497Superfamily c.8.1: Phosphohistidine domain [52009] (2 families) (S)
    contains barrel, closed, n=7, S=10
  5. 1155498Family c.8.1.1: Pyruvate phosphate dikinase, central domain [52010] (1 protein)
  6. 1155499Protein Pyruvate phosphate dikinase, central domain [52011] (3 species)
  7. 1155500Species Clostridium symbiosum [TaxId:1512] [52012] (8 PDB entries)
  8. 1155502Domain d1kc7a2: 1kc7 A:377-509 [68424]
    Other proteins in same PDB: d1kc7a1, d1kc7a3
    complexed with mg, ppr, so4

Details for d1kc7a2

PDB Entry: 1kc7 (more details), 2.2 Å

PDB Description: Pyruvate Phosphate Dikinase with Bound Mg-phosphonopyruvate
PDB Compounds: (A:) pyruvate phosphate dikinase

SCOPe Domain Sequences for d1kc7a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kc7a2 c.8.1.1 (A:377-509) Pyruvate phosphate dikinase, central domain {Clostridium symbiosum [TaxId: 1512]}
lhptfnpaalkagevigsalpaspgaaagkvyftadeakaahekgervilvrletspedi
egmhaaegiltvrggmtshaavvargmgtccvsgcgeikineeaktfelgghtfaegdyi
sldgstgkiykgd

SCOPe Domain Coordinates for d1kc7a2:

Click to download the PDB-style file with coordinates for d1kc7a2.
(The format of our PDB-style files is described here.)

Timeline for d1kc7a2: