| Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
| Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (5 superfamilies) |
Superfamily c.8.1: Phosphohistidine domain [52009] (2 families) ![]() |
| Family c.8.1.1: Pyruvate phosphate dikinase, central domain [52010] (1 protein) |
| Protein Pyruvate phosphate dikinase, central domain [52011] (2 species) |
| Species Clostridium symbiosum [TaxId:1512] [52012] (6 PDB entries) |
| Domain d1kc7a2: 1kc7 A:377-509 [68424] Other proteins in same PDB: d1kc7a1, d1kc7a3 |
PDB Entry: 1kc7 (more details), 2.2 Å
SCOP Domain Sequences for d1kc7a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kc7a2 c.8.1.1 (A:377-509) Pyruvate phosphate dikinase, central domain {Clostridium symbiosum}
lhptfnpaalkagevigsalpaspgaaagkvyftadeakaahekgervilvrletspedi
egmhaaegiltvrggmtshaavvargmgtccvsgcgeikineeaktfelgghtfaegdyi
sldgstgkiykgd
Timeline for d1kc7a2: