Lineage for d1kc6b_ (1kc6 B:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 123984Fold c.52: Restriction endonuclease-like [52979] (3 superfamilies)
  4. 123985Superfamily c.52.1: Restriction endonuclease-like [52980] (19 families) (S)
  5. 124165Family c.52.1.19: Restriction endonuclease HincII [69525] (1 protein)
  6. 124166Protein Restriction endonuclease HincII [69526] (1 species)
  7. 124167Species Haemophilus influenzae [TaxId:727] [69527] (1 PDB entry)
  8. 124169Domain d1kc6b_: 1kc6 B: [68420]

Details for d1kc6b_

PDB Entry: 1kc6 (more details), 2.6 Å

PDB Description: HincII Bound to Cognate DNA

SCOP Domain Sequences for d1kc6b_:

Sequence, based on SEQRES records: (download)

>d1kc6b_ c.52.1.19 (B:) Restriction endonuclease HincII {Haemophilus influenzae}
sfikpiyqdinsiligqkvkrpksgtlsghaagepfeklvykflkenlsdltfkqyeyln
dlfmknpaiighearyklfnsptllfllsrgkaatenwsienlfeekqndtadillvkdq
fyelldvktrnisksaqapniisayklaqtcakmidnkefdlfdinylevdwelngedlv
cvstsfaelfksepselyinwaaamqiqfhvrdldqgfngtreewaksylkhfvtqaeqr
aismidkfvkpfkkyi

Sequence, based on observed residues (ATOM records): (download)

>d1kc6b_ c.52.1.19 (B:) Restriction endonuclease HincII {Haemophilus influenzae}
sfikpiyqdinsiligqkvkraagepfeklvykflkenlsdltfkqyeylndlfmknpai
ighearyklfnsptllfllsrgkaatenwsienlfeekqndtadillvkdqfyelldvkt
rnisksaqapniisayklaqtcakmidnkefdlfdinylevdwelngedlvcvstsfael
fksepselyinwaaamqiqfhvrdldqgfngtreewaksylkhfvtqaeqraismidkfv
kpfkkyi

SCOP Domain Coordinates for d1kc6b_:

Click to download the PDB-style file with coordinates for d1kc6b_.
(The format of our PDB-style files is described here.)

Timeline for d1kc6b_: