SCOPe 2.07: Domain d1kbwf1: 1kbw F:13-163

Lineage for d1kbwf1 (1kbw F:13-163)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins)

6. Protein Nitrite reductase, NIR [49551] (5 species)
   consists of two domains of this fold

7. Species Neisseria gonorrhoeae, AniA [TaxId:485] [69193] (2 PDB entries)

8. Domain d1kbwf1: 1kbw F:13-163 [68417]
   complexed with cu

Details for d1kbwf1

PDB Entry: 1kbw, 2.4 Å

PDB Description: crystal structure of the soluble domain of ania from neisseria gonorrhoeae

PDB Compounds: (F:) Major outer membrane protein PAN 1

SCOPe Domain Sequences for d1kbwf1:

Sequence; same for both SEQRES and ATOM records:

>d1kbwf1 b.6.1.3 (F:13-163) Nitrite reductase, NIR {Neisseria gonorrhoeae, AniA [TaxId: 485]}
elpvidavtthapevppaidrdypakvrvkmetvektmkmddgveyrywtfdgdvpgrmi
rvregdtvevefsnnpsstvphnvdfhaatgqgggaaatftapgrtstfsfkalqpglyi
yhcavapvgmhiangmyglilvepkeglpkv

Timeline for d1kbwf1:

• d1kbwf1 first appeared in SCOP 1.59
  
• d1kbwf1 appears in SCOPe 2.06
  
• d1kbwf1 appears in the current release, SCOPe 2.08