| Class b: All beta proteins [48724] (126 folds) |
| Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (5 families) ![]() contains copper-binding site |
| Family b.6.1.3: Multidomain cupredoxins [49550] (6 proteins) |
| Protein Nitrite reductase, NIR [49551] (4 species) consists of two domains of this fold |
| Species Neisseria gonorrhoeae, AniA [TaxId:485] [69193] (2 PDB entries) |
| Domain d1kbwe2: 1kbw E:164-314 [68416] |
PDB Entry: 1kbw (more details), 2.4 Å
SCOP Domain Sequences for d1kbwe2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kbwe2 b.6.1.3 (E:164-314) Nitrite reductase, NIR {Neisseria gonorrhoeae, AniA}
dkefyivqgdfytkgkkgaqglqpfdmdkavaeqpeyvvfnghvgaltgdnalkakaget
vrmyvgnggpnlvssfhvigeifdkvyveggklinenvqstivpaggsaivefkvdipgn
ytlvdhsifrafnkgalgqlkvegaenpeim
Timeline for d1kbwe2: