Lineage for d1kbwe1 (1kbw E:13-163)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 660498Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 660499Superfamily b.6.1: Cupredoxins [49503] (7 families) (S)
    contains copper-binding site
  5. 660887Family b.6.1.3: Multidomain cupredoxins [49550] (7 proteins)
  6. 661004Protein Nitrite reductase, NIR [49551] (5 species)
    consists of two domains of this fold
  7. 661252Species Neisseria gonorrhoeae, AniA [TaxId:485] [69193] (2 PDB entries)
  8. 661273Domain d1kbwe1: 1kbw E:13-163 [68415]

Details for d1kbwe1

PDB Entry: 1kbw (more details), 2.4 Å

PDB Description: crystal structure of the soluble domain of ania from neisseria gonorrhoeae
PDB Compounds: (E:) Major outer membrane protein PAN 1

SCOP Domain Sequences for d1kbwe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kbwe1 b.6.1.3 (E:13-163) Nitrite reductase, NIR {Neisseria gonorrhoeae, AniA [TaxId: 485]}
elpvidavtthapevppaidrdypakvrvkmetvektmkmddgveyrywtfdgdvpgrmi
rvregdtvevefsnnpsstvphnvdfhaatgqgggaaatftapgrtstfsfkalqpglyi
yhcavapvgmhiangmyglilvepkeglpkv

SCOP Domain Coordinates for d1kbwe1:

Click to download the PDB-style file with coordinates for d1kbwe1.
(The format of our PDB-style files is described here.)

Timeline for d1kbwe1: