Lineage for d1kbwd1 (1kbw D:13-163)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2380192Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2380193Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2381028Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins)
  6. 2381275Protein Nitrite reductase, NIR [49551] (5 species)
    consists of two domains of this fold
  7. 2381654Species Neisseria gonorrhoeae, AniA [TaxId:485] [69193] (2 PDB entries)
  8. 2381673Domain d1kbwd1: 1kbw D:13-163 [68413]
    complexed with cu

Details for d1kbwd1

PDB Entry: 1kbw (more details), 2.4 Å

PDB Description: crystal structure of the soluble domain of ania from neisseria gonorrhoeae
PDB Compounds: (D:) Major outer membrane protein PAN 1

SCOPe Domain Sequences for d1kbwd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kbwd1 b.6.1.3 (D:13-163) Nitrite reductase, NIR {Neisseria gonorrhoeae, AniA [TaxId: 485]}
elpvidavtthapevppaidrdypakvrvkmetvektmkmddgveyrywtfdgdvpgrmi
rvregdtvevefsnnpsstvphnvdfhaatgqgggaaatftapgrtstfsfkalqpglyi
yhcavapvgmhiangmyglilvepkeglpkv

SCOPe Domain Coordinates for d1kbwd1:

Click to download the PDB-style file with coordinates for d1kbwd1.
(The format of our PDB-style files is described here.)

Timeline for d1kbwd1: