| Class b: All beta proteins [48724] (178 folds) |
| Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
| Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins) |
| Protein Nitrite reductase, NIR [49551] (5 species) consists of two domains of this fold |
| Species Neisseria gonorrhoeae, AniA [TaxId:485] [69193] (2 PDB entries) |
| Domain d1kbwc2: 1kbw C:164-314 [68412] complexed with cu |
PDB Entry: 1kbw (more details), 2.4 Å
SCOPe Domain Sequences for d1kbwc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kbwc2 b.6.1.3 (C:164-314) Nitrite reductase, NIR {Neisseria gonorrhoeae, AniA [TaxId: 485]}
dkefyivqgdfytkgkkgaqglqpfdmdkavaeqpeyvvfnghvgaltgdnalkakaget
vrmyvgnggpnlvssfhvigeifdkvyveggklinenvqstivpaggsaivefkvdipgn
ytlvdhsifrafnkgalgqlkvegaenpeim
Timeline for d1kbwc2: