SCOP 1.59: Domain d1kbwc2: 1kbw C:164-314

Lineage for d1kbwc2 (1kbw C:164-314)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.6: Cupredoxins [49502] (1 superfamily)

4. Superfamily b.6.1: Cupredoxins [49503] (4 families)

5. Family b.6.1.3: Multidomain cupredoxins [49550] (5 proteins)

6. Protein Nitrite reductase, NIR [49551] (4 species)

7. Species Neisseria gonorrhoeae, AniA [TaxId:485] [69193] (2 PDB entries)

8. Domain d1kbwc2: 1kbw C:164-314 [68412]

Details for d1kbwc2

PDB Entry: 1kbw, 2.4 Å

PDB Description: crystal structure of the soluble domain of ania from neisseria gonorrhoeae

SCOP Domain Sequences for d1kbwc2:

Sequence; same for both SEQRES and ATOM records:

>d1kbwc2 b.6.1.3 (C:164-314) Nitrite reductase, NIR {Neisseria gonorrhoeae, AniA}
dkefyivqgdfytkgkkgaqglqpfdmdkavaeqpeyvvfnghvgaltgdnalkakaget
vrmyvgnggpnlvssfhvigeifdkvyveggklinenvqstivpaggsaivefkvdipgn
ytlvdhsifrafnkgalgqlkvegaenpeim

Timeline for d1kbwc2:

• d1kbwc2 is new in SCOP 1.59
  
• d1kbwc2 appears in SCOP 1.61
  
• d1kbwc2 appears in the current release, SCOPe 2.08