Lineage for d1kbwb2 (1kbw B:164-314)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2771244Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins)
  6. 2771509Protein Nitrite reductase, NIR, C-terminal domain [418911] (5 species)
  7. Species Neisseria gonorrhoeae, AniA [TaxId:485] [419331] (2 PDB entries)
  8. 2771713Domain d1kbwb2: 1kbw B:164-314 [68410]
    Other proteins in same PDB: d1kbwa1, d1kbwb1, d1kbwc1, d1kbwd1, d1kbwe1, d1kbwf1
    complexed with cu
    has additional insertions and/or extensions that are not grouped together

Details for d1kbwb2

PDB Entry: 1kbw (more details), 2.4 Å

PDB Description: crystal structure of the soluble domain of ania from neisseria gonorrhoeae
PDB Compounds: (B:) Major outer membrane protein PAN 1

SCOPe Domain Sequences for d1kbwb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kbwb2 b.6.1.3 (B:164-314) Nitrite reductase, NIR, C-terminal domain {Neisseria gonorrhoeae, AniA [TaxId: 485]}
dkefyivqgdfytkgkkgaqglqpfdmdkavaeqpeyvvfnghvgaltgdnalkakaget
vrmyvgnggpnlvssfhvigeifdkvyveggklinenvqstivpaggsaivefkvdipgn
ytlvdhsifrafnkgalgqlkvegaenpeim

SCOPe Domain Coordinates for d1kbwb2:

Click to download the PDB-style file with coordinates for d1kbwb2.
(The format of our PDB-style files is described here.)

Timeline for d1kbwb2: