Lineage for d1kbwa2 (1kbw A:164-314)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 162480Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
  4. 162481Superfamily b.6.1: Cupredoxins [49503] (5 families) (S)
  5. 162779Family b.6.1.3: Multidomain cupredoxins [49550] (5 proteins)
  6. 162851Protein Nitrite reductase, NIR [49551] (4 species)
  7. 162965Species Neisseria gonorrhoeae, AniA [TaxId:485] [69193] (2 PDB entries)
  8. 162979Domain d1kbwa2: 1kbw A:164-314 [68408]

Details for d1kbwa2

PDB Entry: 1kbw (more details), 2.4 Å

PDB Description: crystal structure of the soluble domain of ania from neisseria gonorrhoeae

SCOP Domain Sequences for d1kbwa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kbwa2 b.6.1.3 (A:164-314) Nitrite reductase, NIR {Neisseria gonorrhoeae, AniA}
dkefyivqgdfytkgkkgaqglqpfdmdkavaeqpeyvvfnghvgaltgdnalkakaget
vrmyvgnggpnlvssfhvigeifdkvyveggklinenvqstivpaggsaivefkvdipgn
ytlvdhsifrafnkgalgqlkvegaenpeim

SCOP Domain Coordinates for d1kbwa2:

Click to download the PDB-style file with coordinates for d1kbwa2.
(The format of our PDB-style files is described here.)

Timeline for d1kbwa2: