![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (7 families) ![]() contains copper-binding site |
![]() | Family b.6.1.3: Multidomain cupredoxins [49550] (7 proteins) |
![]() | Protein Nitrite reductase, NIR [49551] (5 species) consists of two domains of this fold |
![]() | Species Neisseria gonorrhoeae, AniA [TaxId:485] [69193] (2 PDB entries) |
![]() | Domain d1kbvc2: 1kbv C:164-314 [68400] |
PDB Entry: 1kbv (more details), 1.95 Å
SCOP Domain Sequences for d1kbvc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kbvc2 b.6.1.3 (C:164-314) Nitrite reductase, NIR {Neisseria gonorrhoeae, AniA [TaxId: 485]} dkefyivqgdfytkgkkgaqglqpfdmdkavaeqpeyvvfnghvgaltgdnalkakaget vrmyvgnggpnlvssfhvigeifdkvyveggklinenvqstivpaggsaivefkvdipgn ytlvdhsifrafnkgalgqlkvegaenpeim
Timeline for d1kbvc2: