Lineage for d1kbvb1 (1kbv B:13-163)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 369112Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 369113Superfamily b.6.1: Cupredoxins [49503] (5 families) (S)
    contains copper-binding site
  5. 369433Family b.6.1.3: Multidomain cupredoxins [49550] (6 proteins)
  6. 369511Protein Nitrite reductase, NIR [49551] (4 species)
    consists of two domains of this fold
  7. 369691Species Neisseria gonorrhoeae, AniA [TaxId:485] [69193] (2 PDB entries)
  8. 369694Domain d1kbvb1: 1kbv B:13-163 [68397]

Details for d1kbvb1

PDB Entry: 1kbv (more details), 1.95 Å

PDB Description: nitrite-soaked crystal structure of the soluble domain of ania from neisseria gonorrhoeae

SCOP Domain Sequences for d1kbvb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kbvb1 b.6.1.3 (B:13-163) Nitrite reductase, NIR {Neisseria gonorrhoeae, AniA}
elpvidavtthapevppaidrdypakvrvkmetvektmkmddgveyrywtfdgdvpgrmi
rvregdtvevefsnnpsstvphnvdfhaatgqgggaaatftapgrtstfsfkalqpglyi
yhcavapvgmhiangmyglilvepkeglpkv

SCOP Domain Coordinates for d1kbvb1:

Click to download the PDB-style file with coordinates for d1kbvb1.
(The format of our PDB-style files is described here.)

Timeline for d1kbvb1: