Lineage for d1kbqd_ (1kbq D:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 120208Fold c.23: Flavodoxin-like [52171] (17 superfamilies)
  4. 120383Superfamily c.23.5: Flavoproteins [52218] (3 families) (S)
  5. 120474Family c.23.5.3: Quinone reductase [52235] (2 protein domains)
  6. 120475Protein NAD(P)H:quinone reductase [52236] (3 species)
  7. 120476Species Human (Homo sapiens) [TaxId:9606] [52239] (8 PDB entries)
  8. 120484Domain d1kbqd_: 1kbq D: [68394]

Details for d1kbqd_

PDB Entry: 1kbq (more details), 1.8 Å

PDB Description: Complex of Human NAD(P)H quinone Oxidoreductase with 5-methoxy-1,2-dimethyl-3-(4-nitrophenoxymethyl)indole-4,7-dione (ES936)

SCOP Domain Sequences for d1kbqd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kbqd_ c.23.5.3 (D:) NAD(P)H:quinone reductase {Human (Homo sapiens)}
grralivlahsertsfnyamkeaaaaalkkkgwevvesdlyamnfnpiisrkditgklkd
panfqypaesvlaykeghlspdivaeqkkleaadlvifqfplqwfgvpailkgwfervfi
gefaytyaamydkgpfrskkavlsittggsgsmyslqgihgdmnvilwpiqsgilhfcgf
qvlepqltysightpadariqilegwkkrleniwdetplyfapsslfdlnfqagflmkke
vqdeeknkkfglsvghhlgksiptdnqikark

SCOP Domain Coordinates for d1kbqd_:

Click to download the PDB-style file with coordinates for d1kbqd_.
(The format of our PDB-style files is described here.)

Timeline for d1kbqd_: