Lineage for d1kbqc_ (1kbq C:)
- Root: SCOP 1.61
Class c: Alpha and beta proteins (a/b) [51349] (117 folds) 
Fold c.23: Flavodoxin-like [52171] (16 superfamilies) 
Superfamily c.23.5: Flavoproteins [52218] (3 families) 
Family c.23.5.3: Quinone reductase [52235] (2 proteins) Protein NAD(P)H:quinone reductase [52236] (3 species) Species Human (Homo sapiens) [TaxId:9606] [52239] (8 PDB entries) 
Domain d1kbqc_: 1kbq C: [68393]
Details for d1kbqc_
PDB Entry: 1kbq (more details), 1.8 Å
PDB Description: Complex of Human NAD(P)H quinone Oxidoreductase with 5-methoxy-1,2-dimethyl-3-(4-nitrophenoxymethyl)indole-4,7-dione (ES936)
SCOP Domain Sequences for d1kbqc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kbqc_ c.23.5.3 (C:) NAD(P)H:quinone reductase {Human (Homo sapiens)}
rralivlahsertsfnyamkeaaaaalkkkgwevvesdlyamnfnpiisrkditgklkdp
anfqypaesvlaykeghlspdivaeqkkleaadlvifqfplqwfgvpailkgwfervfig
efaytyaamydkgpfrskkavlsittggsgsmyslqgihgdmnvilwpiqsgilhfcgfq
vlepqltysightpadariqilegwkkrleniwdetplyfapsslfdlnfqagflmkkev
qdeeknkkfglsvghhlgksiptdnqikark
SCOP Domain Coordinates for d1kbqc_:
Click to download the PDB-style file with coordinates for d1kbqc_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1kbqc_:
- d1kbqc_ first appeared in SCOP 1.59
- d1kbqc_ appears in SCOP 1.63
- d1kbqc_ appears in the current release, SCOPe 2.08
View in 3D
