Lineage for d1kbqb_ (1kbq B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2463694Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2464623Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 2464786Family c.23.5.3: Quinone reductase [52235] (4 proteins)
    binds FAD
  6. 2464800Protein NAD(P)H:quinone reductase [52236] (3 species)
  7. 2464801Species Human (Homo sapiens) [TaxId:9606] [52239] (9 PDB entries)
  8. 2464803Domain d1kbqb_: 1kbq B: [68392]
    complexed with 936, fad

Details for d1kbqb_

PDB Entry: 1kbq (more details), 1.8 Å

PDB Description: Complex of Human NAD(P)H quinone Oxidoreductase with 5-methoxy-1,2-dimethyl-3-(4-nitrophenoxymethyl)indole-4,7-dione (ES936)
PDB Compounds: (B:) nad(p)h dehydrogenase [quinone] 1

SCOPe Domain Sequences for d1kbqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kbqb_ c.23.5.3 (B:) NAD(P)H:quinone reductase {Human (Homo sapiens) [TaxId: 9606]}
rralivlahsertsfnyamkeaaaaalkkkgwevvesdlyamnfnpiisrkditgklkdp
anfqypaesvlaykeghlspdivaeqkkleaadlvifqfplqwfgvpailkgwfervfig
efaytyaamydkgpfrskkavlsittggsgsmyslqgihgdmnvilwpiqsgilhfcgfq
vlepqltysightpadariqilegwkkrleniwdetplyfapsslfdlnfqagflmkkev
qdeeknkkfglsvghhlgksiptdnqikark

SCOPe Domain Coordinates for d1kbqb_:

Click to download the PDB-style file with coordinates for d1kbqb_.
(The format of our PDB-style files is described here.)

Timeline for d1kbqb_: