Lineage for d1kbqa_ (1kbq A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1837702Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1838447Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 1838601Family c.23.5.3: Quinone reductase [52235] (4 proteins)
    binds FAD
  6. 1838615Protein NAD(P)H:quinone reductase [52236] (3 species)
  7. 1838616Species Human (Homo sapiens) [TaxId:9606] [52239] (8 PDB entries)
  8. 1838617Domain d1kbqa_: 1kbq A: [68391]
    complexed with 936, fad

Details for d1kbqa_

PDB Entry: 1kbq (more details), 1.8 Å

PDB Description: Complex of Human NAD(P)H quinone Oxidoreductase with 5-methoxy-1,2-dimethyl-3-(4-nitrophenoxymethyl)indole-4,7-dione (ES936)
PDB Compounds: (A:) nad(p)h dehydrogenase [quinone] 1

SCOPe Domain Sequences for d1kbqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kbqa_ c.23.5.3 (A:) NAD(P)H:quinone reductase {Human (Homo sapiens) [TaxId: 9606]}
grralivlahsertsfnyamkeaaaaalkkkgwevvesdlyamnfnpiisrkditgklkd
panfqypaesvlaykeghlspdivaeqkkleaadlvifqfplqwfgvpailkgwfervfi
gefaytyaamydkgpfrskkavlsittggsgsmyslqgihgdmnvilwpiqsgilhfcgf
qvlepqltysightpadariqilegwkkrleniwdetplyfapsslfdlnfqagflmkke
vqdeeknkkfglsvghhlgksiptdnqikark

SCOPe Domain Coordinates for d1kbqa_:

Click to download the PDB-style file with coordinates for d1kbqa_.
(The format of our PDB-style files is described here.)

Timeline for d1kbqa_: