Lineage for d1kbla3 (1kbl A:2-376)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2978525Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2978526Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. 2978813Family d.142.1.5: Pyruvate phosphate dikinase, N-terminal domain [56085] (2 proteins)
    automatically mapped to Pfam PF01326
  6. 2978814Protein Pyruvate phosphate dikinase, N-terminal domain [56086] (3 species)
    the common fold is interrupted by a 4-helical subdomain (residues 112-198)
  7. 2978815Species Clostridium symbiosum [TaxId:1512] [56087] (7 PDB entries)
  8. 2978816Domain d1kbla3: 1kbl A:2-376 [68386]
    Other proteins in same PDB: d1kbla1, d1kbla2
    complexed with nh4, so4

Details for d1kbla3

PDB Entry: 1kbl (more details), 1.94 Å

PDB Description: pyruvate phosphate dikinase
PDB Compounds: (A:) pyruvate phosphate dikinase

SCOPe Domain Sequences for d1kbla3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kbla3 d.142.1.5 (A:2-376) Pyruvate phosphate dikinase, N-terminal domain {Clostridium symbiosum [TaxId: 1512]}
akwvykfeegnasmrnllggkgcnlaemtilgmpipqgftvtteacteyynsgkqitqei
qdqifeaitwleelngkkfgdtedpllvsvrsgarasmpgmmdtilnlglndvavegfak
ktgnprfaydsyrrfiqmysdvvmevpkshfekiidamkeekgvhfdtdltaddlkelae
kfkavykeamngeefpqepkdqlmgavkavfrswdnpraivyrrmndipgdwgtavnvqt
mvfgnkgetsgtgvaftrnpstgekgiygeylinaqgedvvagvrtpqpitqlendmpdc
ykqfmdlamklekhfrdmqdmeftieegklyflqtrngkrtapaalqiacdlvdegmite
eeavvrieaksldql

SCOPe Domain Coordinates for d1kbla3:

Click to download the PDB-style file with coordinates for d1kbla3.
(The format of our PDB-style files is described here.)

Timeline for d1kbla3: