SCOP 1.73: Domain d1kbla2: 1kbl A:377-509

Lineage for d1kbla2 (1kbl A:377-509)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies)
   3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
   this domain is thought to be mobile in most multi-domain proteins known to contain it

4. Superfamily c.8.1: Phosphohistidine domain [52009] (2 families)
   contains barrel, closed, n=7, S=10

5. Family c.8.1.1: Pyruvate phosphate dikinase, central domain [52010] (1 protein)

6. Protein Pyruvate phosphate dikinase, central domain [52011] (3 species)

7. Species Clostridium symbiosum [TaxId:1512] [52012] (7 PDB entries)

8. Domain d1kbla2: 1kbl A:377-509 [68385]
   Other proteins in same PDB: d1kbla1, d1kbla3
   complexed with nh4, so4

Details for d1kbla2

PDB Entry: 1kbl, 1.94 Å

PDB Description: pyruvate phosphate dikinase

PDB Compounds: (A:) pyruvate phosphate dikinase

SCOP Domain Sequences for d1kbla2:

Sequence; same for both SEQRES and ATOM records:

>d1kbla2 c.8.1.1 (A:377-509) Pyruvate phosphate dikinase, central domain {Clostridium symbiosum [TaxId: 1512]}
lhptfnpaalkagevigsalpaspgaaagkvyftadeakaahekgervilvrletspedi
egmhaaegiltvrggmtshaavvargmgtccvsgcgeikineeaktfelgghtfaegdyi
sldgstgkiykgd

Timeline for d1kbla2:

• d1kbla2 first appeared in SCOP 1.59
  
• d1kbla2 appears in SCOP 1.71
  
• d1kbla2 appears in SCOP 1.75
  
• d1kbla2 appears in the current release, SCOPe 2.08