Lineage for d1kbla2 (1kbl A:377-509)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 119570Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (5 superfamilies)
  4. 119571Superfamily c.8.1: Phosphohistidine domain [52009] (2 families) (S)
  5. 119572Family c.8.1.1: Pyruvate phosphate dikinase, central domain [52010] (1 protein)
  6. 119573Protein Pyruvate phosphate dikinase, central domain [52011] (1 species)
  7. 119574Species Clostridium symbiosum [TaxId:1512] [52012] (6 PDB entries)
  8. 119575Domain d1kbla2: 1kbl A:377-509 [68385]
    Other proteins in same PDB: d1kbla1, d1kbla3

Details for d1kbla2

PDB Entry: 1kbl (more details), 1.94 Å

PDB Description: pyruvate phosphate dikinase

SCOP Domain Sequences for d1kbla2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kbla2 c.8.1.1 (A:377-509) Pyruvate phosphate dikinase, central domain {Clostridium symbiosum}
lhptfnpaalkagevigsalpaspgaaagkvyftadeakaahekgervilvrletspedi
egmhaaegiltvrggmtshaavvargmgtccvsgcgeikineeaktfelgghtfaegdyi
sldgstgkiykgd

SCOP Domain Coordinates for d1kbla2:

Click to download the PDB-style file with coordinates for d1kbla2.
(The format of our PDB-style files is described here.)

Timeline for d1kbla2: